| Chemical Name | Cytidine-5’-monophospho-9-azido-9-deoxy-N-acetylneuraminic acid (Ammonium Salt) |
|---|---|
| Synonyms | CMP-9-AzNeu5Ac, CMP-C9-Azido-Sialic Acid |
| Molecular Formula | C20H29N7O15P · NH4 |
| Molecular Weight | 656.51 g/mol (ammonium salt) |
| Related CAS No. | 112037-53-3 (free acid) |
| Appearance | Lyophilized white powder |
| Purity | ≥95% (HPLC) |
| Solubility | Soluble in water |
| Storage | −20°C, protect from moisture |
| Application | Activated sugar nucleotide donor substrate for sialyltransferases; enables bioorthogonal click chemistry labeling of sialylated glycoconjugates via azide–alkyne cycloaddition (CuAAC/SPAAC) |
10 in stock
| Chemical Name | Cytidine-5’-monophospho-N-glycolylneuraminic acid, Disodium Salt |
|---|---|
| Synonyms | CMP-Neu5Gc·2Na, CMP-NeuGc Disodium Salt, CMP-N-Glycolylneuraminic Acid Disodium Salt |
| Molecular Formula | C20H29N4O17P · 2Na |
| Molecular Weight | 674.41 g/mol |
| CAS No. | 98396-76-0 |
| Appearance | White lyophilized powder |
| Purity | ≥95% (HPLC) |
| Source | Enzymatic synthesis |
| Solubility | Soluble in water |
| Storage | −20°C, protect from moisture |
| Application | Activated sugar nucleotide donor substrate for sialyltransferases; used in enzymatic glycolyl-sialylation of glycoproteins, glycolipids, and oligosaccharides; key tool for studying non-human Neu5Gc expression and anti-Neu5Gc immune responses |
10 in stock
| Name | Glucose PEG Succinimidyl Carboxymethyl Ester |
| Catalog No. | A14-1001 |
| CAS Number | NA |
| Formula | NA |
| M.W. | MW 35000 (GLUC-SCM-35K) |
10 in stock
Amino acid sequence : ATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNR WNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Linker : GSGHHHHHH
Molecular Weight: 46kDa* (SEC-MALS)
*The size is larger than conventional recombinant STxB due to the linker before HIS-tag.
Purity : >94% (SEC-MALS; SEC)
Form Soluble in DPBS, w/o: Ca2+ and Mg2+
Stored Frozen, 1 mg/mL in 0.5 mL
Shipped in Dry Ice
Expressed in E. coli
10 in stock
| Name | UDP-6-azido-6-doexy-GalNAc.2Na |
| Catalog No. | GN02091 |
| CAS Number | 1202854-87-2 |
| Formula | C17H24N6Na2O16P2 |
| M.W. | 676.65 |
10 in stock
10 in stock
9 in stock
Glycodepot serve all your needs in glycoscience from products, services, networking and announcements. Get the best glycoscience products and services to support your research. Shop Now and learn about cutting-edge solutions in glycochemistry, glycobiology, and glyco-analysis!
![UDP-[UL-¹³C] Glucuronic Acid](https://glycodepot.com/wp-content/uploads/2024/08/UDP-UL-¹³C-Glucuronic-Acid.png)
