Catalog No: A10GD-4335
Cas No: 138-52-3
Properties: Mol Formula: C13H18O7, Mol Weight: 286.28
IUPAC Name: (2R,3S,4S,5R,6S)-2-(hydroxymethyl)-6-[2-(hydroxymethyl)phenoxy]oxane-3,4,5-triol
Synonym: Salicoside, D-(-)-Salicin, D(-)-Salicin
10 in stock
Salidroside (Sal) is a natural compound from Rhodiola rosea known for its antioxidant, anti-inflammatory, and neuroprotective properties. CAS 10338-51-9.
| Name | Salmon-Gal |
| Synonyms | 6-Chloro-3-indolyl-β-D-galactopyranoside |
| CAS Number | 138182-21-5 |
| Molecular Formula | C14H16ClNO6 |
| Molecular Weight | 329.73 g/mol |
| Specifications & Purity | ≥95% (Vacuum foil packaging) |
| Product Name | Salmon-GalNAc |
| Chemical Name | 6-Chloro-3-indolyl N-acetyl-β-D-galactosaminide |
| CAS Number | 501432-61-7 |
| Molecular Formula | C16H19ClN2O6 |
| Molecular Weight | 370.79 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
| Product Name | Salmon-Glc |
| Chemical Name | 6-Chloro-3-indolyl β-D-glucopyranoside |
| CAS Number | 159954-28-6 |
| Molecular Formula | C14H16ClNO6 |
| Molecular Weight | 329.73 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
| Product Name | Salmon-GlcA CHX Salt |
| Chemical Name | 6-Chloro-3-indolyl β-D-glucuronide cyclohexylammonium salt |
| CAS Number | 138182-20-4 |
| Molecular Formula | C14H14ClNO7 · C6H13N |
| Molecular Weight | 442.89 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
| Product Name | Salmon-GlcA Sodium Salt |
| Chemical Name | 6-Chloro-3-indolyl β-D-glucuronide sodium salt |
| CAS Number | 216971-56-1 |
| Molecular Formula | C14H13ClNNaO7 |
| Molecular Weight | 365.70 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
| Product Name | Salmon-α-Gal |
| Chemical Name | 6-Chloro-3-indolyl α-D-galactopyranoside |
| CAS Number | 198402-61-8 |
| Molecular Formula | C14H16ClNO6 |
| Molecular Weight | 329.73 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
| Product Name | Salmon-α-Glc |
| Chemical Name | 6-Chloro-3-indolyl α-D-glucopyranoside |
| CAS Number | 467214-46-6 |
| Molecular Formula | C14H16ClNO6 |
| Molecular Weight | 329.73 |
| Purity | 98% |
| Packaging | Vacuum foil packaging |
Catalog No: A10GD-4055
Cas No: 783350-52-7
Properties: Mol Formula: C5H8O5, Mol Weight: 148.11
IUPAC Name: 2,3,4-trihydroxypentanedial
Synonym: 783350-52-7, ,
10 in stock
Amino acid sequence : ATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNR WNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Linker : GSGHHHHHH
Molecular Weight: 46kDa* (SEC-MALS)
*The size is larger than conventional recombinant STxB due to the linker before HIS-tag.
Purity : >94% (SEC-MALS; SEC)
Form Soluble in DPBS, w/o: Ca2+ and Mg2+
Stored Frozen, 1 mg/mL in 0.5 mL
Shipped in Dry Ice
Expressed in E. coli
10 in stock
| Name | Sialic acid aldolase (NPL) |
| Catalog No. | EN01027 |
| E.C. | 4.1.3.3 |
10 in stock
Catalog No : A1GO-4202
CAS NO : N/A
Formula: C31H52N2O23
Mol.Wt. 820.75
Package mg , g
10 in stock
Catalog No : A1GO-4423
CAS NO : N/A
Formula: C43H72N2O34
Mol.Wt. 1161.03
Package mg , g
10 in stock
Catalog No : A1GO-4427
CAS NO : N/A
Formula: C37H62N2O29
Mol.Wt. 998.89
Package mg , g
10 in stock
Glycodepot serve all your needs in glycoscience from products, services, networking and announcements. Get the best glycoscience products and services to support your research. Shop Now and learn about cutting-edge solutions in glycochemistry, glycobiology, and glyco-analysis!
![?-D-Mannopyranoside, phenyl 4,6-O-[(R)-phenylmethylene]-1-thio-](https://glycodepot.com/wp-content/uploads/2024/04/159407-19-9-150x75.png)
